Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_2664_iso_7
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB_related
Protein Properties Length: 744aa    MW: 81053.2 Da    PI: 6.4768
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                                         HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding  7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                         eE+ ++++a k++G   W +I +++g ++t+ q++s+ qk+
  cra_locus_2664_iso_7_len_3106_ver_3  4 EEHNRFLEALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 42
                                         9*************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.2E-4145IPR001005SANT/Myb domain
PROSITE profilePS5129418.189147IPR017930Myb domain
CDDcd001672.41E-6443No hitNo description
PfamPF002492.3E-9441IPR001005SANT/Myb domain
TIGRFAMsTIGR015578.3E-12445IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 744 aa     Download sequence    Send to blast
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00119DAPTransfer from AT1G01060Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010661519.10.0PREDICTED: protein LHY-like isoform X4
RefseqXP_010661518.10.0PREDICTED: protein LHY-like isoform X4
RefseqXP_010661517.10.0PREDICTED: protein LHY-like isoform X4
RefseqXP_010661513.10.0PREDICTED: protein LHY-like isoform X4
RefseqXP_010661512.10.0PREDICTED: protein LHY-like isoform X3
RefseqXP_010661511.10.0PREDICTED: protein LHY-like isoform X3
TrEMBLA0A068UJ960.0A0A068UJ96_COFCA; Uncharacterized protein
STRINGVIT_15s0048g02410.t010.0(Vitis vinifera)